all domains info — 2,016,840

eg bmw.info, toyota.info (quote without www or http)
2,016,840
check domain

Information about e-a-t.info (Escola de Aprofundamento Teológico)

Rating

Last update: 23.07.2016 в 07:29 (update every 3 days)
E-A-T.info it takes #NA among the popular websites all over the internet. The lower the score, the more visitors from this site. Domain age e-a-t.info is no data, the first time it has been registered no data. Now located on the service registrar nic-handle — no data. DNS addresses, which is located e-a-t.info: ns362.hostgator.com.br, ns363.hostgator.com.br ip-address that hosts the domain: 108.167.188.42. Name e-a-t.info refers to 5-character domains. Add your reviews about e-a-t.info below in the form of.
Domain name: e-a-t.info
Name: Escola de Aprofundamento Teológico
Description: Site Oficial da Escola de Aprofundamento Teológico de Fortaleza, veículo de divulgação para alunos e professores de teologia.
Keywords: Aprofundamento, Teologia, CS Lewis, Ufologia, Escatologia
Alexa Rank: Available after update Show History Alexa Rank ↓ Hide story Alexa Rank ↑
Refers to the site (data Alexa): Available after update
The presence in the DMOZ directory: Available after update
DNS-server: ns362.hostgator.com.br
ns363.hostgator.com.br
Provider: AS20013 CyrusOne LLC
Organization: CyrusOne LLC
Country: United States, Texas, Houston
How many characters in domain: 5
IP that hosts the domain: 108.167.188.42 (all sites on this IP)
Analysis e-a-t.info
Google PageRank: Available after update
Indexed pages in Google: show
Links to site in Google: show
Search traffic:
e-a-t.info - reviews
Recently watched

10delisle.info searched 4 seconds ago

teachersadler.info searched 5 seconds ago

guardsmanscientific.info searched 7 seconds ago

destinationedinburghapartments.info searched 36 seconds ago

0068.info searched 40 seconds ago

ifthesehallscouldspeak.info searched 43 seconds ago

kardiologie-berlin.info searched 48 seconds ago

peter-klein-historiker.info searched 55 seconds ago

0024.info searched 1 minute 1 second ago

y-oneplace.info searched 1 minute 6 seconds ago

content-parking.info searched 1 minute 25 seconds ago

tphod.info searched 1 minute 25 seconds ago

delraydentalimplants.info searched 1 minute 33 seconds ago

dafayulechengzenmeyang.info searched 1 minute 36 seconds ago

healthinsurancemarketplacepennsylvania.info searched 1 minute 38 seconds ago

mnjy.info searched 1 minute 38 seconds ago

louisvahandbags.info searched 1 minute 43 seconds ago

psychotherapie-muenster.info searched 1 minute 45 seconds ago

logistikberatung.info searched 1 minute 46 seconds ago

we-are-charity-people.info searched 1 minute 47 seconds ago

Fast passage: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z   0-9