all domains info — 2,016,839

eg bmw.info, toyota.info (quote without www or http)
2,016,839
check domain

Information about i-nove.info

Rating

Last update: 12.09.2016 в 19:24 (update every 3 days)
I-Nove.info it takes #NA among the popular websites all over the internet. The lower the score, the more visitors from this site. Domain age i-nove.info is no data, the first time it has been registered no data. Now located on the service registrar nic-handle — no data. DNS addresses, which is located i-nove.info: ns63.domaincontrol.com, ns64.domaincontrol.com ip-address that hosts the domain: 50.63.202.37. Name i-nove.info refers to 6-character domains. Add your reviews about i-nove.info below in the form of.
Domain name: i-nove.info
Name: -
Description: -
Keywords: -
Alexa Rank: Available after update Show History Alexa Rank ↓ Hide story Alexa Rank ↑
Refers to the site (data Alexa): Available after update
The presence in the DMOZ directory: Available after update
DNS-server: ns63.domaincontrol.com
ns64.domaincontrol.com
Provider: AS26496 GoDaddy.com, LLC
Organization: GoDaddy.com, LLC
Country: United States, Arizona, Scottsdale
How many characters in domain: 6
IP that hosts the domain: 50.63.202.37 (all sites on this IP)
Analysis i-nove.info
Google PageRank: Available after update
Indexed pages in Google: show
Links to site in Google: show
Search traffic:
i-nove.info - reviews
Recently watched

silvercreekacademicacademy.info searched 1 second ago

eastperth.info searched 2 seconds ago

john-darer.info searched 3 seconds ago

whaletone.info searched 3 seconds ago

phpcaptcha.info searched 4 seconds ago

volmervideo.info searched 4 seconds ago

l-arn.info searched 10 seconds ago

latraffic.info searched 11 seconds ago

proaction.info searched 12 seconds ago

nfcafrica.info searched 13 seconds ago

calgarytravelclinic.info searched 29 seconds ago

syntheticengineoil.info searched 32 seconds ago

designrow.info searched 35 seconds ago

whatdoestuxedoattiremean.info searched 36 seconds ago

aeroporto.info searched 44 seconds ago

sonicolor.info searched 44 seconds ago

voicemail.info searched 44 seconds ago

free-eagle.info searched 45 seconds ago

hanf-nuss.info searched 45 seconds ago

omote-nasi.info searched 46 seconds ago

Fast passage: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z   0-9