all domains info — 2,016,839

eg bmw.info, toyota.info (quote without www or http)
2,016,839
check domain

Information about i-plus1.info (Société de recherche d’informations spécifiques › i+1)

Rating

Last update: 12.09.2016 в 19:30 (update every 3 days)
I-Plus1.info it takes #NA among the popular websites all over the internet. The lower the score, the more visitors from this site. Domain age i-plus1.info is no data, the first time it has been registered no data. Now located on the service registrar nic-handle — no data. DNS addresses, which is located i-plus1.info: dns101.ovh.net, ns101.ovh.net ip-address that hosts the domain: 185.17.240.15. Name i-plus1.info refers to 7-character domains. Add your reviews about i-plus1.info below in the form of.
Domain name: i-plus1.info
Name: Société de recherche d’informations spécifiques › i+1
Description: i+1 effectue de la veille pour les professionnels dans le but de collecter des informations permettant de mettre en place des stratégies efficaces.
Keywords: -
Alexa Rank: Available after update Show History Alexa Rank ↓ Hide story Alexa Rank ↑
Refers to the site (data Alexa): Available after update
The presence in the DMOZ directory: Available after update
DNS-server: dns101.ovh.net
ns101.ovh.net
Provider: AS61136 IES-AS
Organization: I.E.S. Informatique SARL
Country: France, Alsace, Entzheim
How many characters in domain: 7
IP that hosts the domain: 185.17.240.15 (all sites on this IP)
Analysis i-plus1.info
Google PageRank: Available after update
Indexed pages in Google: show
Links to site in Google: show
Search traffic:
i-plus1.info - reviews
Recently watched

maxsenden.info searched 1 second ago

zatinex.info searched 2 seconds ago

i-nove.info searched 5 seconds ago

silvercreekacademicacademy.info searched 6 seconds ago

eastperth.info searched 7 seconds ago

john-darer.info searched 8 seconds ago

whaletone.info searched 8 seconds ago

phpcaptcha.info searched 9 seconds ago

volmervideo.info searched 9 seconds ago

l-arn.info searched 15 seconds ago

latraffic.info searched 16 seconds ago

proaction.info searched 17 seconds ago

nfcafrica.info searched 18 seconds ago

calgarytravelclinic.info searched 34 seconds ago

syntheticengineoil.info searched 37 seconds ago

designrow.info searched 40 seconds ago

whatdoestuxedoattiremean.info searched 41 second ago

aeroporto.info searched 49 seconds ago

sonicolor.info searched 49 seconds ago

voicemail.info searched 49 seconds ago

Fast passage: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z   0-9