all domains info — 2,016,839

eg bmw.info, toyota.info (quote without www or http)
2,016,839
check domain

Information about l-glycin.info (l-glycin.info)

Rating

Last update: 13.10.2016 в 08:56 (update every 3 days)
L-Glycin.info it takes #NA among the popular websites all over the internet. The lower the score, the more visitors from this site. Domain age l-glycin.info is no data, the first time it has been registered no data. Now located on the service registrar nic-handle — no data. DNS addresses, which is located l-glycin.info: ns1.fastpark.net, ns2.fastpark.net ip-address that hosts the domain: 185.53.177.9. Name l-glycin.info refers to 8-character domains. Add your reviews about l-glycin.info below in the form of.
Domain name: l-glycin.info
Name: l-glycin.info
Description: -
Keywords: -
Alexa Rank: Available after update Show History Alexa Rank ↓ Hide story Alexa Rank ↑
Refers to the site (data Alexa): Available after update
The presence in the DMOZ directory: Available after update
DNS-server: ns1.fastpark.net
ns2.fastpark.net
Provider: AS61969 TEAMINTERNET-AS
Organization: Team Internet AG
Country: Germany, Bavaria, Munich (Altstadt-Lehel)
How many characters in domain: 8
IP that hosts the domain: 185.53.177.9 (all sites on this IP)
Analysis l-glycin.info
Google PageRank: Available after update
Indexed pages in Google: show
Links to site in Google: show
Search traffic:
l-glycin.info - reviews
Recently watched

sankt-englmar-bayerischer-wald.info searched 1 second ago

zueri.info searched 3 seconds ago

spacecoasttechnical.info searched 5 seconds ago

i-pc.info searched 6 seconds ago

ajwed.info searched 8 seconds ago

pastlivesdreamsandsoultravel.info searched 8 seconds ago

urpl.info searched 8 seconds ago

a-ie.info searched 11 seconds ago

l-glutamin.info searched 14 seconds ago

lionsrock.info searched 15 seconds ago

watchlock.info searched 15 seconds ago

i-order.info searched 17 seconds ago

i-plus1.info searched 20 seconds ago

maxsenden.info searched 21 second ago

zatinex.info searched 22 seconds ago

i-nove.info searched 25 seconds ago

silvercreekacademicacademy.info searched 26 seconds ago

eastperth.info searched 27 seconds ago

john-darer.info searched 28 seconds ago

whaletone.info searched 28 seconds ago

Fast passage: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z   0-9