all domains info — 2,016,840

eg bmw.info, toyota.info (quote without www or http)
2,016,840
check domain

Information about o-arubabeach.info (Aruba's Premier condominium | The perfect beach is Only the beginning)

Rating

Last update: 14.10.2016 в 07:29 (update every 3 days)
O-Arubabeach.info it takes #NA among the popular websites all over the internet. The lower the score, the more visitors from this site. Domain age o-arubabeach.info is no data, the first time it has been registered no data. Now located on the service registrar nic-handle — no data. DNS addresses, which is located o-arubabeach.info: ns2.orbitalnets.com, ns1.orbitalnets.com ip-address that hosts the domain: 72.29.85.20. Name o-arubabeach.info refers to 12-character domains. Add your reviews about o-arubabeach.info below in the form of.
Domain name: o-arubabeach.info
Name: Aruba's Premier condominium | The perfect beach is Only the beginning
Description: O Condominium is a Aruba's Premier Beach Front Condominium, consisting of 20 Exclusive condominiums, and located at the prestigious Eagle Beach.
Keywords: -
Alexa Rank: Available after update Show History Alexa Rank ↓ Hide story Alexa Rank ↑
Refers to the site (data Alexa): Available after update
The presence in the DMOZ directory: Available after update
DNS-server: ns2.orbitalnets.com
ns1.orbitalnets.com
Provider: AS33182 HostDime.com, Inc.
Organization: HostDime.com
Country: United States, Florida, Orlando
How many characters in domain: 12
IP that hosts the domain: 72.29.85.20 (all sites on this IP)
Analysis o-arubabeach.info
Google PageRank: Available after update
Indexed pages in Google: show
Links to site in Google: show
Search traffic:
o-arubabeach.info - reviews
Recently watched

augenarzt-muenchen.info searched 4 seconds ago

kayakrockypoint.info searched 8 seconds ago

o-h-30.info searched 16 seconds ago

chirurgie-esthetique-lyon.info searched 17 seconds ago

qplhhbqg.info searched 17 seconds ago

automotiveinsurance.info searched 19 seconds ago

philadelphiacriminallawyer.info searched 21 second ago

fine-old-silver.info searched 24 seconds ago

networkedverticalsolutions.info searched 25 seconds ago

scuolasnowboard.info searched 26 seconds ago

carlsonwagonlitravel.info searched 29 seconds ago

sparkstreatmentcenters.info searched 32 seconds ago

wadigraphic.info searched 34 seconds ago

njsportsadvantage.info searched 48 seconds ago

officiallinks.info searched 53 seconds ago

ferienwohnung-verpoort.info searched 54 seconds ago

zzo.info searched 56 seconds ago

controlthis.info searched 1 minute ago

silviaschneider.info searched 1 minute 5 seconds ago

audit-garant.info searched 1 minute 8 seconds ago

Fast passage: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z   0-9