all domains info — 2,016,839

eg bmw.info, toyota.info (quote without www or http)
2,016,839
check domain

Information about zatinex.info (Domain Registered at Safenames)

Rating

Last update: 25.10.2016 в 10:50 (update every 3 days)
Zatinex.info it takes #NA among the popular websites all over the internet. The lower the score, the more visitors from this site. Domain age zatinex.info is no data, the first time it has been registered no data. Now located on the service registrar nic-handle — no data. DNS addresses, which is located zatinex.info: dns1.idp365.net, dns2.idp365.net ip-address that hosts the domain: 217.19.248.132. Name zatinex.info refers to 7-character domains. Add your reviews about zatinex.info below in the form of.
Domain name: zatinex.info
Name: Domain Registered at Safenames
Description: -
Keywords: -
Alexa Rank: Available after update Show History Alexa Rank ↓ Hide story Alexa Rank ↑
Refers to the site (data Alexa): Available after update
The presence in the DMOZ directory: Available after update
DNS-server: dns1.idp365.net
dns2.idp365.net
dns3.idp365.net
Provider: AS60819 SAFENAMES-AS
Organization: Dedicated Server Hosting
Country: United Kingdom, England, Wavendon
How many characters in domain: 7
IP that hosts the domain: 217.19.248.132 (all sites on this IP)
Analysis zatinex.info
Google PageRank: Available after update
Indexed pages in Google: show
Links to site in Google: show
Search traffic:
zatinex.info - reviews
Recently watched

i-nove.info searched 3 seconds ago

silvercreekacademicacademy.info searched 4 seconds ago

eastperth.info searched 5 seconds ago

john-darer.info searched 6 seconds ago

whaletone.info searched 6 seconds ago

phpcaptcha.info searched 7 seconds ago

volmervideo.info searched 7 seconds ago

l-arn.info searched 13 seconds ago

latraffic.info searched 14 seconds ago

proaction.info searched 15 seconds ago

nfcafrica.info searched 16 seconds ago

calgarytravelclinic.info searched 32 seconds ago

syntheticengineoil.info searched 35 seconds ago

designrow.info searched 38 seconds ago

whatdoestuxedoattiremean.info searched 39 seconds ago

aeroporto.info searched 47 seconds ago

sonicolor.info searched 47 seconds ago

voicemail.info searched 47 seconds ago

free-eagle.info searched 48 seconds ago

hanf-nuss.info searched 48 seconds ago

Fast passage: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z   0-9